PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART01G33600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 715aa    MW: 78803.9 Da    PI: 7.5272
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART01G33600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox42.21.3e-1374128256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r+ +++t +q e+Le +F  + +p+  ++++L++ +gL  +qVk+WFqN+R++ k
  OBART01G33600.1  74 RRLQRLTGKQSEVLEGFFSICGHPDDGQKRHLSETTGLGLDQVKFWFQNKRTQVK 128
                      445789*********************************************9877 PP

2START88.81.1e-282284432205
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EEEEEE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla...kaetle 83 
                      la  a+ +l+ +a++  ++W+ ++    e +n++ + q  + +++     +++ea ra+ +v m+   +v  l+d    + + ++   + ++++
  OBART01G33600.1 228 LAKNAMHALIILAESHVALWFPVPgcsyEVLNKMAYDQAYPGDNSanaigFKTEATRAVSMVMMDYKSVVDFLMDPY-NYRTFFPeviSGAVTN 320
                      6788999999**************999988888888888866666888999****************6665555555.5555555444999999 PP

                      EECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
            START  84 vissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                      +i +        g++qlm+ e++++splvp R+ +f+Ry+  l++g  v+ dvS+d  +  +      ++++ pSg+li++   + +kvt +eh
  OBART01G33600.1 321 RIYTWptsdgynGVIQLMTVEMMFPSPLVPaRKCTFLRYCNVLNEGLVVVIDVSLDDGSIFS------KCRKMPSGFLIQSIRPNSCKVTAIEH 408
                      9977777789*********************************************9988866......7************************* PP

                      EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      v  ++  +h+l+++ ++ gl++ga++wvat+ rq +
  OBART01G33600.1 409 VLADDTGVHELYQPCMN-GLVFGARRWVATMARQSA 443
                      **************985.89***********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-1565132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-1465124IPR009057Homeodomain-like
PROSITE profilePS5007114.26870130IPR001356Homeobox domain
CDDcd000861.55E-1271130No hitNo description
SMARTSM003893.5E-1072134IPR001356Homeobox domain
PfamPF000463.4E-1174128IPR001356Homeobox domain
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PROSITE profilePS5084818.551218447IPR002913START domain
CDDcd088755.53E-94222443No hitNo description
SMARTSM002341.7E-7227444IPR002913START domain
PfamPF018521.2E-21228443IPR002913START domain
SuperFamilySSF559613.02E-20277442No hitNo description
SuperFamilySSF559611.1E-8461669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MEMNQQHNEG NESFVALMNG VAGDGTATLP LVSFNQNDGE QSMSIPAREL FAAIEADSGL  60
LPVNSSNTNE KRKRRLQRLT GKQSEVLEGF FSICGHPDDG QKRHLSETTG LGLDQVKFWF  120
QNKRTQVKTM CWKEENYKLS VENEILRDEN RRVKIAHCTA ICLTCRNSSV QNQLAVEMER  180
LMGQSERLQQ EIARSNGTPP AANLAFQLNS SADYVFSGQH DQQMIAELAK NAMHALIILA  240
ESHVALWFPV PGCSYEVLNK MAYDQAYPGD NSANAIGFKT EATRAVSMVM MDYKSVVDFL  300
MDPYNYRTFF PEVISGAVTN RIYTWPTSDG YNGVIQLMTV EMMFPSPLVP ARKCTFLRYC  360
NVLNEGLVVV IDVSLDDGSI FSKCRKMPSG FLIQSIRPNS CKVTAIEHVL ADDTGVHELY  420
QPCMNGLVFG ARRWVATMAR QSARMRDVHH NKTAPQVSTK GRKNLMKLAD DLLASFAGGI  480
TATGGGTWTV VIGAGTEKDI RVAYRRTTEG SSSYNAILSV SASLRLPLPM RKTFDLLRNL  540
THRCKWDVLV HGSVVKEEVT IARGVGNDDT VTVLHCKRAG REDRGRTMIL QNNGYDASGS  600
FMVYSQIDSE LMNTMVLSPS DLPPGRGGPS LYPTGFSLLP DVEAAQDSSG IALGEVGGTL  660
MTMGFQIPVK LASGDRMYSR SAASAIRLMT DTIALVKKTL MNEHSGIYGV SPFHP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3178820.0AF317882.1 Oryza sativa transcription factor 1 (TF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632244.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLA0A0D3EUX90.0A0A0D3EUX9_9ORYZ; Uncharacterized protein
STRINGORGLA01G0275300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.21e-105HD-ZIP family protein